PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10258_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 177aa    MW: 20678 Da    PI: 10.6439
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10258_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-17246448
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         WT eEd  l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  cra_locus_10258_iso_1_len_528_ver_3  2 WTVEEDFTLINYIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 46
                                         *******************************************97 PP

2Myb_DNA-binding52.61e-165295146
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  cra_locus_10258_iso_1_len_528_ver_3 52 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 95
                                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.291146IPR017930Myb domain
SMARTSM007173.4E-10148IPR001005SANT/Myb domain
SuperFamilySSF466893.26E-29293IPR009057Homeodomain-like
CDDcd001671.54E-10246No hitNo description
PfamPF002493.5E-15246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-22253IPR009057Homeodomain-like
PROSITE profilePS5129423.24647101IPR017930Myb domain
SMARTSM007171.3E-145199IPR001005SANT/Myb domain
PfamPF002492.1E-155295IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2354100IPR009057Homeodomain-like
CDDcd001679.87E-77295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
XWTVEEDFTL INYIAHHGEG RWNSLARCAG LKRTGKSCRL RWLNYLRPDV RRGNITLEEQ  60
LLILELHSRW GNRWSKIAQH LPGRTDNEIK NYWRTRVQKH AKQLKCDVNS KQFKDTMRYL  120
WMPRLVERIQ AAASASSSNN SSATATTTVP PPNSTIMSPN MNMDMTNNMQ QQQQQQX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-2329330120MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075113.18e-98PREDICTED: transcription factor MYB108
RefseqXP_004239882.18e-98PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-80MY108_ARATH; Transcription factor MYB108
TrEMBLK4C2139e-98K4C213_SOLLC; Uncharacterized protein
STRINGSolyc05g053330.2.13e-97(Solanum lycopersicum)